PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30024.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 323aa    MW: 36208.5 Da    PI: 6.4016
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30024.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.81.5e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++lv++++++G g+W++ ++  g++R++k+c++rw +yl
  mrna30024.1-v1.0-hybrid 14 KGPWTPEEDQKLVQYIQEHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding52.51.1e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++++eE++ +++++ +lG++ W++Ia ++  gRt++++k++w+++l
  mrna30024.1-v1.0-hybrid  67 RGNFSQEEEQTILHLHSLLGNK-WSAIATHLS-GRTDNEIKNFWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.876961IPR017930Myb domain
SuperFamilySSF466898.99E-3211108IPR009057Homeodomain-like
SMARTSM007173.3E-161363IPR001005SANT/Myb domain
PfamPF002491.9E-181461IPR001005SANT/Myb domain
CDDcd001673.51E-131661No hitNo description
PROSITE profilePS5129426.23262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2765117IPR009057Homeodomain-like
SMARTSM007171.0E-1566114IPR001005SANT/Myb domain
PfamPF002492.3E-1567112IPR001005SANT/Myb domain
CDDcd001671.28E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGKSHCCDES GLKKGPWTPE EDQKLVQYIQ EHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF SQEEEQTILH LHSLLGNKWS AIATHLSGRT DNEIKNFWNT HLKKKLIQMG  120
IDPMTHQPRT DLFSNLQDLL PLQYQSLDQH GATSLHDAAE AVAQLVKLQY LHQQYVLQSH  180
LLNTNVGSYD PPPPIKENLP VLNSSHLVIE SPSSFSQPLH YGTLVPHHEN PQVPFSSFAV  240
SEIDPMVSSL SQAEEKNPPE MYEYSPSFLQ YSSNIPTPLA DPLINNPGEA SCSTSSNGGI  300
RSTTSSSYWS ELLIEETKTN YD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300644.10.0PREDICTED: transcription factor MYB39
SwissprotQ8GWP02e-76MYB39_ARATH; Transcription factor MYB39
TrEMBLM5XKW71e-117M5XKW7_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s17080.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-95myb domain protein 93